Dermazone StoreDermazone StoreDermazone Store

Coxir Ultra Hyaluronic Ampoule - 50 ml

ريال114.38

جميع الأسعار شاملة الضريبة

  • Ultra hyaluronic ampoule for extra skin care
  • Repair the skin from deep inside
  • Lighten dark spots and get rid of fine lines
  • All skin types
  • Enhance skin texture
  • Get rid of skin dryness

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Product Overview

We choose for you this hyaluronic ampoule, which is a light watery gel for moisturizing and skin care. Because it contains a high concentration of hyaluronic acid, collagen, vitamin B5, and cica plant extract, up to 40%, to give the skin maximum hydration, especially dry skin.

This product also contains other natural ingredients that repair the layers of the skin from deep within. By nourishing it and supplying it with the necessary elements that lock moisture in the skin to maintain its health and freshness.

This ampoule is suitable for sensitive skin. Because of its ability to soothe the skin and relieve the effects of irritation and redness.

Product Details

Product size: 50 ml

Brand: Coxir.

Made in: Korea.

Skin Type: All Skin Types.

Instructions Of Use

  • Wash off your face very well.
  • Put a proper amount of Ultra Hyaluronic Toner on a piece of cotton and wipe the entire face with it. To enhance absorption into the skin.
  • Apply an appropriate amount to the face and gently massage the product; For double hydration.

Ingredients

Hyaluronic Acid: It gives an immediate and deep hydration to the skin.

Aloe Vera Extract: deeply moisturizes and soothes the skin.

Hydrolyzed Collagen: It is the protein responsible for the elasticity and health of the skin.

Cica Extract: effectively restores and moisturizes the skin, soothes the skin and reduces fine lines and wrinkles.

Vitamin B5: lighten dark spots, nourish and moisturize the skin, and improve its elasticity.

Extract Of 6 Natural Plants: soothes the skin and strengthens its external barrier, and also enhances hydration.

Allantoin: Promotes the skin healing process and reduces the effects of burns, wounds and scars.

Why Use Ultra Hyaluronic Ampoule

  • Light watery texture that does not leave stickiness on the skin.
  • Soothe the skin and relieve redness and irritation.
  • Deep hydration and repair of skin layers.
  • Free of parabens, fragrances, alcohol and other harsh substances.

Warnings

  • For external use only.
  • Avoid contact with eyes.
  • Keep out of reach of children.
  • Stop using the product if signs of irritation appear.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 1 review
100%
(1)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
م
محمد علوي

كوكسير أمبولات ألترا هيالورونيك 50 مل

Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Coxir Ultra Hyaluronic Ampoule - 50 ml

ريال114.38
Chat now