Dermazone StoreDermazone StoreDermazone Store
Sold out

Moms Bath Deep Body Moisturizing Bundle

ريال783.59

جميع الأسعار شاملة الضريبة

  • Hydrating Body Milk for Skin Brightening
  • Exfoliating Wipes for Radiant Skin and Dead Skin Removal
  • Powerful Exfoliating Mitt for Smooth, Renewed Skin
  • Soy Milk Mask for Deep Skin Hydration
  • Ultimate Body Hydration Bundle for Dead Skin Removal
  • Enhance Radiance, Remove Impurities with Our Exclusive Bundle

Tell me when this product is available

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Viewers are watching this product now

Moms Bath Deep Body Hydration Bundle

Package Details

This bundle is distinguished by its collection of products that address challenging skin problems such as acne, the buildup of dead skin cells, clogged pores, and deep hydration for flawless, intensely moisturized, and blemish-free skin. To learn more about these products, read on.

Moms Bath Vitamin-Infused Exfoliating Body and Face Wipes - 45 Wipes 

These wipes are characterized by their rich content of exfoliating vitamins and moisturizing elements like hyaluronic acid, combined with panthenol, to highlight the freshness and health of your skin for up to 24 hours after use. This blend effectively removes dead skin cells and evens out the skin's texture.

How to Use:

  • Use one wipe to gently rub the entire body, paying special attention to dry areas, while applying pressure during the process.
  • Focus on knees, elbows, and other challenging areas on the body to improve their texture and freshness.
  • Use any remaining oil on the wipe on your hair for added moisture.
  • It is recommended to use these wipes continuously without interruption for maximum freshness and hydration.

Moms Bath Strong Body Exfoliating Mitt 

This strong exfoliating mitt by Moms Bath effectively exfoliates the body and removes oil buildup that can cause skin problems such as acne. It contains an effective cleaning solution composed of fruit enzymes such as fermented pumpkin extract and potent pineapple, which helps eliminate old dead skin, chicken skin, and old scars. Additionally, it contains seaweed extract to provide maximum moisturization.

How to Use:

  • Gently exfoliate the body from the white side after thoroughly rinsing it with water to create a rich, keratin-moisturizing foam.
  • Pay special attention to your ankles, elbows, and other challenging areas of the body to improve their texture and freshness.
  • Rinse your body completely with lukewarm water after exfoliating.
  • It is recommended to use the mitt 2-3 times a week for best results.
  • It is advisable to test the mitt on a small area of the skin to ensure there is no allergic reaction.

Moms Bath Body Milk - 200 ml 

This milk consists of honey and yogurt extracts, known for their high moisturizing properties for the body, whether during or after bathing. This milk contains an expert-developed formula characterized by rapid absorption, skin moisturization, soothing, and noticeable lightening without leaving any stickiness on the body.

How to Use:

  • Use an appropriate amount of milk on the entire wet body, then gently rub it in.
  • Rinse the body completely with water after finishing and then gently dry with a towel.
  • It can be used without rinsing with water for easy absorption into the body to enhance moisture.

Moms Bath Soy Milk Mask - 70g 

This mask is characterized by its highly moisturizing ingredients, as it contains raw soy milk extract rich in skin-drying protein that protects the skin from ultraviolet rays, among other benefits. It also has many other advantages that become apparent with its dense texture, moisturizing the skin, and filling its pores, especially after exposure to steam during a shower.

How to Use:

  • Wash the body thoroughly with water, then exfoliate and clean it.
  • Apply the mask after bathing for 5-10 minutes, then rinse thoroughly.
  • The mask can also be used on the face.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)
Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your shopping cart is empty.

Back to Shop

Add notes to the order Edit notes
Estimate shipping costs
Add discount code

Estimate shipping costs

Add discount code

The coupon code will work on the checkout page

Chat now