Dermazone StoreDermazone StoreDermazone Store

Dermaceutic Sun Ceutic - SPF 50+ Sun Block and Protection

ريال281.20

جميع الأسعار شاملة الضريبة

Maximum protection from the sun's harmful UV rays
Prevents premature aging of skin
Complete hydration of the skin
Boosts age-defense properties and soothes the skin
Unifies skin tone and texture
Suitable for all skin types

Sold out

madaapple paytabbytamarasadadstcpaykfastvisaamerican expressmaster
Order during to get it on hoursminutes
Viewers are watching this product now

Dermaceutic Sun Ceutic +50 SPF 50 ml - Age Defense Sun Protection

Product Overview

Age Defense Sun Protection

Dermaceutic Sun Ceutic is more than just a sunscreen, it combines the benefits of the powerful stem cell stimulator phycosaccharide AIP, hyaluronic acid and aloe vera. Its micro-dispersed mineral filters guarantee perfect transparency.

Sun Ceutic creates a strong protective barrier, provides hydration, and is easy to use. The airless bottle improves the overall hygiene and limits the needs of conservatives.

Why Sun Ceutic?

Sun Ceutic provides very high protection for skin exposed to UV rays and helps to prevent premature aging of skin, such as spots, fine lines and dehydration. Powerful UVA/UVB filters certified at SPF 50+ offer very high protection.

  • SPF 50+ protection from UVA/UVB rays.

  • Unique stem cell stimulator.

  • Prevent signs of photoaging.

  • Ideal for dry to normal skin.

  • Fragrance-Free.

Benefits of Dermaceutic Sun Ceutic

  • Effective protection from harmful UVA/UVB rays.

  • Prevent premature aging of skin, such as spots, fine lines and dehydration.

  • Creates a strong protective barrier, provides hydration.

  • Boosts age-defense properties and soothes the skin.

Product Information

Ingredients

MAIN INGREDIENTS:

  • Anti-aging complex: hyaluronic acid 1%,

  • Aloe vera 2% and phycosaccharide AIP 5%

  • Chemical filters: ethylhexyl methoxycinnamate,

  • Tinosorb M, uvinul A+ and ensulizole

  • Stem Cell Stimulator

  • Mineral sunscreens: zinc oxide and titanium dioxide.

Zinc oxide and Titanium dioxide

These mineral filters form a stable physical barrier against UVB and UVA rays.

Hyaluronic acid

Creates suppleness and firmness, and moisturizes the skin. A genuine molecular “sponge,” hyaluronic acid has the power to retain up to four-hundred times its weight in water.

Aloe vera

Soothes the skin, reduces inflammation, and stimulates the production of collagen to combat skin aging.

OTHER INGREDIENTS:

Aqua(water), C12-15 Alkyl Benzoate, Ethylhexyl methoxycinnamate, Zinc oxide, Dimethicone, Methylene bis-benzotriazole tetramethyl butyl phenol, Diethylamino Hydroxybenzoyl hexyl benzoate, Glycerin, Cyclopentasiloxane, Glyceryl stearate, Peg-100 stearate, Titanium dioxide, Phenylbenzimidazole sulfonic acid, Sorbitan stearate, Cyclohexasiloxane, Hydrolysed wheat protein, Aluminum hydroxide, Stearic acid, Decyl glucoside, Propylene glycol, PVP crosspolymer, Phenoxyethanol, Aloe barbadensis extract, Sucrose cocoate, Triethanolamine, Stearyl alcohol, Hydrolysed algin, DMDM hydantoin, Imidazolidinyl urea, Isostearic Acid, Triethoxycaprylylsilane, Xanthan gum, Disodium EDTA, BHT, Sodium Hyaluronate.

Instructions for use

  1. Apply Sun Ceutic generously on exposed areas, 10 minutes before sun exposure.

  2. Apply two doses of the cream, for the face and neck.

  3. Renew application frequently every 3 to 4 hours.

Warnings

  • Do not leave the product within the reach of children.

  • Rinse under water immediately in case of contact with the eyes.

Product details

  • Pack Size: 50 ml

  • Age Group: 18+

  • Made In: France

  • Brand: Dermaceutic.

CLINICALLY TESTED:

In two vivo studies (independent clinical research organization) on the combined efficacy of Dermaceutic Sun Ceutic and homecare products out of a total of 50 Caucasian, Asian and dark skin volunteers for 56 days:

90% of patients are confident Sun Ceutic 50+ works effectively.

Return and refund policy:

Reporting problems must be within 7 days of the order date.

Shipping costs shall be borne by the customer, maybe they vary according to the country it was shipped to.

The customer shall be borne the customs charges, consequences and responsibility for the customs law for the country which was shipped to.

Return Damaged/Faulty products requests will be sent to the manufacturer, and if they prove the manufacturing defect, the customer can choose between a full refund, including shipping costs, or obtaining an alternative product.

Return the shipment is due to an error in contact information or the customer has not responded, the return value is estimated by the condition of the product, with deduction of shipping and customs fees.

The refund from the company will be through the same method of payment by the customer.

The estimated amount paid by the company shall be refunded within 7 to 21 working days.

cancelling the order before processing and shipping can be done without incurring shipping costs.

refund due to damage to the products by the shipping company will be for the original price of the product, and in the same method of payment, Dermazone store has the right to compensate the customer with a purchase coupon with the same value as the damaged product.

cancelling part of the shipment after it has been prepared and shipped, will be deducted the shipping costs from the total value of the order with any other expenses related to shipping based on the status of the order.

Please don't hesitate to contact us for any problem through e-mail customercare@dermazonestore.com


Customer Reviews

Based on 12 reviews
92%
(11)
8%
(1)
0%
(0)
0%
(0)
0%
(0)
W
Wedad Alalwai

صن سوتيك +50 واقي الشمس - Dermaceutic Sun Ceutic

W
Wafa Nasser

ديرماسوتيك صن سوتيك +50

N
Nagham
لطيف جدا

ممتاز للبشره الحساسه لا يسبب اي تهيج تمتصه البشره و اساس جميل للمكياج

j
jay

حمايه جدا فعاله من الشمس

F
Faizan Faizankhan
Amazing sun screen

I love the coverage and the products works without causing irritation

Liquid error (templates/product line 332): Error in tag 'section' - 'AIO_product_review' is not a valid section type
Sunday, Monday, Tuesday, Wednesday, Thursday, Friday, Saturday
January, February, March, April, May, June, July, August, September, October, November, December
لا تتوفر عناصر كافية. بقي [max] فقط.
Add to My WishlistBrowse my WishlistDelete from my Wishlist
Shopping cart

Your cart is empty

Back to Shop

Add notes on Order تعديل الملاحظات
Estimate shipping costs
Add a discount code

Estimate shipping costs

Add a discount code

The coupon code will work on the checkout page

Dermaceutic Sun Ceutic - SPF 50+ Sun Block and Protection

ريال281.20
Chat now